RELB antibody (C-Term)
-
- Target See all RELB Antibodies
- RELB (V-Rel Reticuloendotheliosis Viral Oncogene Homolog B (RELB))
-
Binding Specificity
- C-Term
-
Reactivity
- Human, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This RELB antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- RELB antibody was raised against the C terminal of RELB
- Purification
- Purified
- Immunogen
- RELB antibody was raised using the C terminal of RELB corresponding to a region with amino acids GPEPLTLDSYQAPGPGDGGTASLVGSNMFPNHYREAAFGGGLLSPGPEAT
- Top Product
- Discover our top product RELB Primary Antibody
-
-
- Application Notes
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
RELB Blocking Peptide, catalog no. 33R-3469, is also available for use as a blocking control in assays to test for specificity of this RELB antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RELB antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RELB (V-Rel Reticuloendotheliosis Viral Oncogene Homolog B (RELB))
- Alternative Name
- RELB (RELB Products)
- Synonyms
- shep antibody, I-REL antibody, IREL antibody, REL-B antibody, XRelB antibody, relb-A antibody, GC-rich antibody, avian reticuloendotheliosis viral (v-rel) oncogene related B antibody, RELB proto-oncogene, NF-kB subunit antibody, v-rel avian reticuloendotheliosis viral oncogene homolog B S homeolog antibody, Relb antibody, RELB antibody, relb.S antibody
- Background
- RELB neither associates with DNA nor with RELA/p65 or REL. It stimulates promoter activity in the presence of NFKB2/p49.
- Molecular Weight
- 62 kDa (MW of target protein)
- Pathways
- NF-kappaB Signaling, RTK Signaling
-