RELB antibody (C-Term)

Catalog No. ABIN629859

Product Details anti-RELB Antibody

Target: RELB (V-Rel Reticuloendotheliosis Viral Oncogene Homolog B (RELB))

Binding Specificity: C-Term

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RELB antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: RELB antibody was raised against the C terminal of RELB

Purification: Purified

Immunogen: RELB antibody was raised using the C terminal of RELB corresponding to a region with amino acids GPEPLTLDSYQAPGPGDGGTASLVGSNMFPNHYREAAFGGGLLSPGPEAT

Application Details

Application Notes: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RELB Blocking Peptide, catalog no. 33R-3469, is also available for use as a blocking control in assays to test for specificity of this RELB antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RELB antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RELB

Target: RELB (V-Rel Reticuloendotheliosis Viral Oncogene Homolog B (RELB))

Alternative Name: RELB (RELB Products)

Synonyms: shep antibody, I-REL antibody, IREL antibody, REL-B antibody, XRelB antibody, relb-A antibody, GC-rich antibody, avian reticuloendotheliosis viral (v-rel) oncogene related B antibody, RELB proto-oncogene, NF-kB subunit antibody, v-rel avian reticuloendotheliosis viral oncogene homolog B S homeolog antibody, Relb antibody, RELB antibody, relb.S antibody

Background: RELB neither associates with DNA nor with RELA/p65 or REL. It stimulates promoter activity in the presence of NFKB2/p49.

Molecular Weight: 62 kDa (MW of target protein)

Pathways: NF-kappaB Signaling, RTK Signaling