MOV10 antibody

Catalog No. ABIN629879

Product Details anti-MOV10 Antibody

Target: MOV10 (Moloney Leukemia Virus 10 (MOV10))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MOV10 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Purified

Immunogen: MOV10 antibody was raised using a synthetic peptide corresponding to a region with amino acids AKLDLQQGQNLLQGLSKLSPSTSGPHSHDYLPQEREGEGGLSLQVEPEWR

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MOV10 Blocking Peptide, catalog no. 33R-1300, is also available for use as a blocking control in assays to test for specificity of this MOV10 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MOV10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MOV10

Target: MOV10 (Moloney Leukemia Virus 10 (MOV10))

Alternative Name: MOV10 (MOV10 Products)

Synonyms: C77703 antibody, Mov-10 antibody, Capza1 antibody, fSAP113 antibody, gb110 antibody, Mov10 RISC complex RNA helicase antibody, Moloney leukemia virus 10 antibody, MOV10 antibody, Mov10 antibody

Background: MOV10 may be an helicase with an important function in development and/or control of cell proliferation.

Molecular Weight: 110 kDa (MW of target protein)

Pathways: Fc-epsilon Receptor Signaling Pathway, EGFR Signaling Pathway, Neurotrophin Signaling Pathway, SARS-CoV-2 Protein Interactome