EXOSC2 antibody (N-Term)
-
- Target See all EXOSC2 Antibodies
- EXOSC2 (Exosome Component 2 (EXOSC2))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This EXOSC2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- EXOSC2 antibody was raised against the N terminal of EXOSC2
- Purification
- Purified
- Immunogen
- EXOSC2 antibody was raised using the N terminal of EXOSC2 corresponding to a region with amino acids RKPLSERLGRDTKKHLVVPGDTITTDTGFMRGHGTYMGEEKLIASVAGSV
- Top Product
- Discover our top product EXOSC2 Primary Antibody
-
-
- Application Notes
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
EXOSC2 Blocking Peptide, catalog no. 33R-8007, is also available for use as a blocking control in assays to test for specificity of this EXOSC2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EXOSC2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- EXOSC2 (Exosome Component 2 (EXOSC2))
- Alternative Name
- EXOSC2 (EXOSC2 Products)
- Background
- EXOSC2 belongs to the exosome, a RNA-processing complex, which is at least involved in the 3' processing of the 7S pre-rRNA to the mature 5.8S rRNA. It exhibits a 3'-5' exoribonuclease activity.
- Molecular Weight
- 32 kDa (MW of target protein)
- Pathways
- SARS-CoV-2 Protein Interactome
-