SNRPA1 antibody (C-Term)

Catalog No. ABIN629923

Product Details anti-SNRPA1 Antibody

Target: SNRPA1 (SNRPA) (Small Nuclear Ribonucleoprotein Polypeptide A (SNRPA))

Binding Specificity: C-Term

Reactivity: Human, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SNRPA1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: SNRPA1 antibody was raised against the C terminal of SNRPA1

Purification: Purified

Immunogen: SNRPA1 antibody was raised using the C terminal of SNRPA1 corresponding to a region with amino acids RRSKTFNPGAGLPTDKKKGGPSPGDVEAIKNAIANASTLAEVERLKGLLQ

Application Details

Application Notes: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SNRPA1 Blocking Peptide, catalog no. 33R-8161, is also available for use as a blocking control in assays to test for specificity of this SNRPA1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SNRPA1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SNRPA1

Target: SNRPA1 (SNRPA) (Small Nuclear Ribonucleoprotein Polypeptide A (SNRPA))

Alternative Name: SNRPA1 (SNRPA Products)

Synonyms: Mud1 antibody, U1-A antibody, U1A antibody, im:7142962 antibody, zgc:101832 antibody, C430021M15Rik antibody, Rnu1a-1 antibody, Rnu1a1 antibody, mud1 antibody, snf antibody, fc19d01 antibody, wu:fc19d01 antibody, zgc:77810 antibody, T30B22.12 antibody, U1SNRNP-SPECIFIC PROTEIN antibody, spliceosomal protein U1A antibody, small nuclear ribonucleoprotein polypeptide A antibody, small nuclear ribonucleoprotein polypeptide A' antibody, small nuclear ribonucleoprotein polypeptide A S homeolog antibody, spliceosomal protein U1A antibody, SNRPA antibody, snrpa1 antibody, Snrpa antibody, snrpa.S antibody, snrpa antibody, U1A antibody

Background: SNRPA1 contains 3 LRR (leucine-rich) repeats and belongs to the U2 small nuclear ribonucleoprotein A family. It is associated with sn-RNP U2 and helps the A' protein to bind stem loop IV of U2 snRNA.

Molecular Weight: 18 kDa (MW of target protein)