Fibrillarin antibody (N-Term)

Catalog No. ABIN629933

Product Details anti-Fibrillarin Antibody

Target: Fibrillarin (FBL)

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Fibrillarin antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: Fibrillarin antibody was raised against the N terminal of FBL

Purification: Purified

Immunogen: Fibrillarin antibody was raised using the N terminal of FBL corresponding to a region with amino acids GGGFHSGGNRGRGRGGKRGNQSGKNVMVEPHRHEGVFICRGKEDALVTKN

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Fibrillarin Blocking Peptide, catalog no. 33R-3279, is also available for use as a blocking control in assays to test for specificity of this Fibrillarin antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBL antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Fibrillarin

Target: Fibrillarin (FBL)

Alternative Name: Fibrillarin (FBL Products)

Synonyms: FIB antibody, FLRN antibody, RNU3IP1 antibody, wu:fb37g12 antibody, zgc:56145 antibody, zgc:77130 antibody, FBL antibody, AL022665 antibody, CG9888 antibody, Dmel\\CG9888 antibody, Fibri antibody, GCR-6 antibody, GCR6 antibody, Pen59C5 antibody, fib antibody, pen59C5 antibody, MGC76139 antibody, fbl antibody, fibrillarin antibody, Fibrillarin antibody, putative fibrillarin antibody, fibrillarin S homeolog antibody, FBL antibody, fbl antibody, Fbl antibody, Fib antibody, fib1 antibody, LMJF_19_0100 antibody, fbl.S antibody

Background: FBL is a component of a nucleolar small nuclear ribonucleoprotein (snRNP) particle thought to participate in the first step in processing preribosomal RNA. It is associated with the U3, U8, and U13 small nuclear RNAs and is located in the dense fibrillar component (DFC) of the nucleolus. FBL contains an N-terminal repetitive domain that is rich in glycine and arginine residues, like fibrillarins in other species. Its central region resembles an RNA-binding domain and contains an RNP consensus sequence. Antisera from approximately 8% of humans with the autoimmune disease scleroderma recognise fibrillarin.

Molecular Weight: 35 kDa (MW of target protein)

Pathways: Ribonucleoside Biosynthetic Process