DDX39 antibody

Catalog No. ABIN629972

Product Details anti-DDX39 Antibody

Target: DDX39 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 39A (DDX39))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DDX39 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Purified

Immunogen: DDX39 antibody was raised using a synthetic peptide corresponding to a region with amino acids MAEQDVENDLLDYDEEEEPQAPQESTPAPPKKDIKGSYVSIHSSGFRDFL

Application Details

Application Notes: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DDX39 Blocking Peptide, catalog no. 33R-5644, is also available for use as a blocking control in assays to test for specificity of this DDX39 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DDX39 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DDX39

Target: DDX39 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 39A (DDX39))

Alternative Name: DDX39 (DDX39 Products)

Synonyms: 2610307C23Rik antibody, BAT1 antibody, DDXL antibody, Ddx39a antibody, URH49 antibody, BAT1L antibody, DDX39 antibody, Ddx39 antibody, Ddxl antibody, ddx39a antibody, wu:fc87b12 antibody, zgc:55881 antibody, DEAD (Asp-Glu-Ala-Asp) box polypeptide 39 antibody, DExD-box helicase 39A antibody, DEAD (Asp-Glu-Ala-Asp) box polypeptide 39Aa antibody, Ddx39 antibody, DDX39A antibody, Ddx39a antibody, ddx39aa antibody

Background: DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of the DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. DDX39 encodes a member of this family. The function of this member has not been determined. Alternative splicing of this gene generates 2 transcript variants encoding different isoforms.

Molecular Weight: 47 kDa (MW of target protein)