PABPC4 antibody (N-Term)

Catalog No. ABIN629988

Product Details anti-PABPC4 Antibody

Target: PABPC4 (Poly(A) Binding Protein, Cytoplasmic 4 (Inducible Form) (PABPC4))

Binding Specificity: N-Term

Reactivity: Human, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PABPC4 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: PABPC4 antibody was raised against the N terminal of PABPC4

Purification: Purified

Immunogen: PABPC4 antibody was raised using the N terminal of PABPC4 corresponding to a region with amino acids AELGAKAKEFTNVYIKNFGEEVDDESLKELFSQFGKTLSVKVMRDPNGKS

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PABPC4 Blocking Peptide, catalog no. 33R-1137, is also available for use as a blocking control in assays to test for specificity of this PABPC4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PABPC4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PABPC4

Target: PABPC4 (Poly(A) Binding Protein, Cytoplasmic 4 (Inducible Form) (PABPC4))

Alternative Name: PABPC4 (PABPC4 Products)

Synonyms: cb12 antibody, sb:cb12 antibody, PABP antibody, ePAB antibody, ePABP antibody, APP-1 antibody, APP1 antibody, PABP4 antibody, iPABP antibody, polyadenylate-binding protein 4 antibody, poly(A) binding protein, cytoplasmic 4 antibody, poly(A) binding protein, cytoplasmic 4 (inducible form) antibody, poly(A) binding protein cytoplasmic 4 L homeolog antibody, poly(A) binding protein cytoplasmic 4 antibody, Bm1_06880 antibody, Pabpc4 antibody, pabpc4 antibody, pabpc4.L antibody, PABPC4 antibody

Background: Poly(A)-binding proteins (PABPs) bind to the poly(A) tail present at the 3-prime ends of most eukaryotic mRNAs. PABPC4 or IPABP (inducible PABP) was isolated as an activation-induced T-cell mRNA encoding a protein. Activation of T cells increased PABPC4 mRNA levels in T cells approximately 5-fold. PABPC4 contains 4 RNA-binding domains and proline-rich C terminus. PABPC4 is localized primarily to the cytoplasm. It is suggested that PABPC4 might be necessary for regulation of stability of labile mRNA species in activated T cells.

Molecular Weight: 71 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interactome