PPIE antibody

Catalog No. ABIN630007

This Rabbit Polyclonal antibody specifically detects PPIE in WB. It exhibits reactivity toward Human, Mouse, Rat, Dog, Zebrafish (Danio rerio) and Drosophila melanogaster.

Quick Overview for PPIE antibody (ABIN630007)

Target: PPIE (Peptidylprolyl Isomerase E (Cyclophilin E) (PPIE))

Reactivity: Human, Mouse, Rat, Dog, Zebrafish (Danio rerio), Drosophila melanogaster

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PPIE antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-PPIE Antibody

Purification: Purified

Immunogen: PPIE antibody was raised using a synthetic peptide corresponding to a region with amino acids RIIPQFMCQGGDFTNHNGTGGKSIYGKKFDDENFILKHTGPGLLSMANSG

Application Details

Application Notes: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PPIE Blocking Peptide, (ABIN5615495), is also available for use as a blocking control in assays to test for specificity of this PPIE antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPIE antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PPIE

Target: PPIE (Peptidylprolyl Isomerase E (Cyclophilin E) (PPIE))

Alternative Name: PPIE

Background: PPIE is a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. This protein contains a highly conserved cyclophilin (CYP) domain as well as an RNA-binding domain.

Molecular Weight: 26 kDa (MW of target protein)