CHRNA5 antibody (Middle Region)

Catalog No. ABIN630102

The Rabbit Polyclonal anti-CHRNA5 antibody (ABIN630102) specifically detects CHRNA5 in WB. The antibody is reactive with Human and Dog samples.

Quick Overview for CHRNA5 antibody (Middle Region) (ABIN630102)

Target: CHRNA5 (Cholinergic Receptor, Nicotinic, alpha 5 (Neuronal) (CHRNA5))

Reactivity: Human, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CHRNA5 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-CHRNA5 Antibody

Binding Specificity: Middle Region

Specificity: CHRNA5 antibody was raised against the middle region of CHRNA5

Purification: Purified

Immunogen: CHRNA5 antibody was raised using the middle region of CHRNA5 corresponding to a region with amino acids DGSQVDIILEDQDVDKRDFFDNGEWEIVSATGSKGNRTDSCCWYPYVTYS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CHRNA5 Blocking Peptide, (ABIN937353), is also available for use as a blocking control in assays to test for specificity of this CHRNA5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHRNA5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CHRNA5

Target: CHRNA5 (Cholinergic Receptor, Nicotinic, alpha 5 (Neuronal) (CHRNA5))

Alternative Name: CHRNA5

Background: Nicotinic acetylcholine receptors (nAChRs), such as CHRNA5, are members of a superfamily of ligand-gated ion channels that mediate fast signal transmission at synapses. The nAChRs are thought to be (hetero)pentamers composed of homologous subunits.

Molecular Weight: 53 kDa (MW of target protein)