CHRNA5 antibody (Middle Region)
-
- Target See all CHRNA5 Antibodies
- CHRNA5 (Cholinergic Receptor, Nicotinic, alpha 5 (Neuronal) (CHRNA5))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CHRNA5 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- CHRNA5 antibody was raised against the middle region of CHRNA5
- Purification
- Purified
- Immunogen
- CHRNA5 antibody was raised using the middle region of CHRNA5 corresponding to a region with amino acids DGSQVDIILEDQDVDKRDFFDNGEWEIVSATGSKGNRTDSCCWYPYVTYS
- Top Product
- Discover our top product CHRNA5 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CHRNA5 Blocking Peptide, catalog no. 33R-1967, is also available for use as a blocking control in assays to test for specificity of this CHRNA5 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHRNA5 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CHRNA5 (Cholinergic Receptor, Nicotinic, alpha 5 (Neuronal) (CHRNA5))
- Alternative Name
- CHRNA5 (CHRNA5 Products)
- Background
- Nicotinic acetylcholine receptors (nAChRs), such as CHRNA5, are members of a superfamily of ligand-gated ion channels that mediate fast signal transmission at synapses. The nAChRs are thought to be (hetero)pentamers composed of homologous subunits.
- Molecular Weight
- 53 kDa (MW of target protein)
-