CHRNA5 antibody (Middle Region)

Catalog No. ABIN630102

Product Details anti-CHRNA5 Antibody

Target: CHRNA5 (Cholinergic Receptor, Nicotinic, alpha 5 (Neuronal) (CHRNA5))

Binding Specificity: Middle Region

Reactivity: Human, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CHRNA5 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: CHRNA5 antibody was raised against the middle region of CHRNA5

Purification: Purified

Immunogen: CHRNA5 antibody was raised using the middle region of CHRNA5 corresponding to a region with amino acids DGSQVDIILEDQDVDKRDFFDNGEWEIVSATGSKGNRTDSCCWYPYVTYS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CHRNA5 Blocking Peptide, catalog no. 33R-1967, is also available for use as a blocking control in assays to test for specificity of this CHRNA5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHRNA5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CHRNA5

Target: CHRNA5 (Cholinergic Receptor, Nicotinic, alpha 5 (Neuronal) (CHRNA5))

Alternative Name: CHRNA5 (CHRNA5 Products)

Synonyms: zgc:110642 antibody, LNCR2 antibody, Acra-5 antibody, Acra5 antibody, cholinergic receptor, nicotinic, alpha 5 antibody, cholinergic receptor nicotinic alpha 5 subunit antibody, cholinergic receptor nicotinic alpha 5 subunit L homeolog antibody, cholinergic receptor, nicotinic, alpha polypeptide 5 antibody, chrna5 antibody, CHRNA5 antibody, chrna5.L antibody, Chrna5 antibody

Background: Nicotinic acetylcholine receptors (nAChRs), such as CHRNA5, are members of a superfamily of ligand-gated ion channels that mediate fast signal transmission at synapses. The nAChRs are thought to be (hetero)pentamers composed of homologous subunits.

Molecular Weight: 53 kDa (MW of target protein)