KCNQ1 antibody (N-Term)
-
- Target See all KCNQ1 Antibodies
- KCNQ1 (Potassium Voltage-Gated Channel, KQT-Like Subfamily, Member 1 (KCNQ1))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Rat, Mouse, Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This KCNQ1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- KCNQ1 antibody was raised against the N terminal of KCNQ1
- Purification
- Purified
- Immunogen
- KCNQ1 antibody was raised using the N terminal of KCNQ1 corresponding to a region with amino acids IVVVASMVVLCVGSKGQVFATSAIRGIRFLQILRMLHVDRQGGTWRLLGS
- Top Product
- Discover our top product KCNQ1 Primary Antibody
-
-
- Application Notes
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
KCNQ1 Blocking Peptide, catalog no. 33R-4211, is also available for use as a blocking control in assays to test for specificity of this KCNQ1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNQ1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- KCNQ1 (Potassium Voltage-Gated Channel, KQT-Like Subfamily, Member 1 (KCNQ1))
- Alternative Name
- KCNQ1 (KCNQ1 Products)
- Background
- KCNQ1 encodes a protein for a voltage-gated potassium channel required for the repolarization phase of the cardiac action potential. The gene product can form heteromultimers with two other potassium channel proteins, KCNE1 and KCNE3. Mutations in KCNQ1 are associated with hereditary long QT syndrome, Romano-Ward syndrome, Jervell and Lange-Nielsen syndrome and familial atrial fibrillation.
- Molecular Weight
- 60 kDa (MW of target protein)
- Pathways
- Negative Regulation of Hormone Secretion, Sensory Perception of Sound
-