SOD1 antibody (N-Term)
-
- Target See all SOD1 Antibodies
- SOD1 (Superoxide Dismutase 1, Soluble (SOD1))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SOD1 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificity
- SOD1 antibody was raised against the N terminal of SOD1
- Purification
- Purified
- Immunogen
- SOD1 antibody was raised using the N terminal of SOD1 corresponding to a region with amino acids MATKAVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHE
- Top Product
- Discover our top product SOD1 Primary Antibody
-
-
- Application Notes
-
WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SOD1 Blocking Peptide, catalog no. 33R-5777, is also available for use as a blocking control in assays to test for specificity of this SOD1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SOD1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SOD1 (Superoxide Dismutase 1, Soluble (SOD1))
- Alternative Name
- SOD1 (SOD1 Products)
- Background
- SOD1 binds copper and zinc ions and is one of two isozymes responsible for destroying free superoxide radicals in the body. This isozyme is a soluble cytoplasmic protein, acting as a homodimer to convert naturally-occuring but harmful superoxide radicals to molecular oxygen and hydrogen peroxide. The other isozyme is a mitochondrial protein. Mutations in its gene have been implicated as causes of familial amyotrophic lateral sclerosis.
- Molecular Weight
- 16 kDa (MW of target protein)
- Pathways
- Sensory Perception of Sound, Transition Metal Ion Homeostasis
-