SOD1 antibody (N-Term)

Catalog No. ABIN630121

This Rabbit Polyclonal antibody specifically detects SOD1 in WB and IHC. It exhibits reactivity toward Human.

Quick Overview for SOD1 antibody (N-Term) (ABIN630121)

Target: SOD1 (Superoxide Dismutase 1, Soluble (SOD1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SOD1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-SOD1 Antibody

Binding Specificity: N-Term

Specificity: SOD1 antibody was raised against the N terminal of SOD1

Purification: Purified

Immunogen: SOD1 antibody was raised using the N terminal of SOD1 corresponding to a region with amino acids MATKAVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHE

Application Details

Application Notes: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SOD1 Blocking Peptide, (ABIN5616333), is also available for use as a blocking control in assays to test for specificity of this SOD1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SOD1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SOD1

Target: SOD1 (Superoxide Dismutase 1, Soluble (SOD1))

Alternative Name: SOD1

Background: SOD1 binds copper and zinc ions and is one of two isozymes responsible for destroying free superoxide radicals in the body. This isozyme is a soluble cytoplasmic protein, acting as a homodimer to convert naturally-occuring but harmful superoxide radicals to molecular oxygen and hydrogen peroxide. The other isozyme is a mitochondrial protein. Mutations in its gene have been implicated as causes of familial amyotrophic lateral sclerosis.

Molecular Weight: 16 kDa (MW of target protein)

Pathways: Sensory Perception of Sound, Transition Metal Ion Homeostasis