Glypican 3 antibody (Middle Region)

Catalog No. ABIN630140

Product Details anti-Glypican 3 Antibody

Target: Glypican 3 (GPC3)

Binding Specificity: Middle Region

Reactivity: Human, Rat, Mouse, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Glypican 3 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: GPC3 antibody was raised against the middle region of GPC3

Purification: Purified

Immunogen: GPC3 antibody was raised using the middle region of GPC3 corresponding to a region with amino acids FSTIHDSIQYVQKNAGKLTTTIGKLCAHSQQRQYRSAYYPEDLFIDKKVL

Application Details

Application Notes: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GPC3 Blocking Peptide, catalog no. 33R-3080, is also available for use as a blocking control in assays to test for specificity of this GPC3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GPC3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Glypican 3

Target: Glypican 3 (GPC3)

Alternative Name: GPC3 (GPC3 Products)

Background: Cell surface heparan sulfate proteoglycans are composed of a membrane-associated protein core substituted with a variable number of heparan sulfate chains. Members of the glypican-related integral membrane proteoglycan family (GRIPS) contain a core protein anchored to the cytoplasmic membrane via a glycosyl phosphatidylinositol linkage. These proteins may play a role in the control of cell division and growth regulation. Deletion mutations in this gene are associated with Simpson-Golabi-Behmel syndrome.

Molecular Weight: 64 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process