MCM7 antibody (Middle Region)

Catalog No. ABIN630194

The Rabbit Polyclonal anti-MCM7 antibody has been validated for WB. It is suitable to detect MCM7 in samples from Human, Mouse, Rat and Dog.

Quick Overview for MCM7 antibody (Middle Region) (ABIN630194)

Target: MCM7 (Minichromosome Maintenance Complex Component 7 (MCM7))

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MCM7 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-MCM7 Antibody

Binding Specificity: Middle Region

Specificity: MCM7 antibody was raised against the middle region of MCM7

Purification: Purified

Immunogen: MCM7 antibody was raised using the middle region of MCM7 corresponding to a region with amino acids GGRSVRFSEAEQRCVSRGFTPAQFQAALDEYEELNVWQVNASRTRITFV

Application Details

Application Notes: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MCM7 Blocking Peptide, (ABIN938684), is also available for use as a blocking control in assays to test for specificity of this MCM7 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MCM7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MCM7

Target: MCM7 (Minichromosome Maintenance Complex Component 7 (MCM7))

Alternative Name: MCM7

Background: MCM7 encodes a protein that is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are essential for the initiation of eukaryotic genome replication. The hexameric protein complex formed by the MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. The MCM complex consisting of this protein and MCM2, 4 and 6 proteins possesses DNA helicase activity, and may act as a DNA unwinding enzyme.

Molecular Weight: 42 kDa (MW of target protein)

Pathways: DNA Damage Repair, Mitotic G1-G1/S Phases, DNA Replication, Chromatin Binding, Synthesis of DNA