RNASEH2A antibody (Middle Region)

Catalog No. ABIN630199

This Rabbit Polyclonal antibody specifically detects RNASEH2A in WB and IHC. It exhibits reactivity toward Human and Zebrafish (Danio rerio).

Quick Overview for RNASEH2A antibody (Middle Region) (ABIN630199)

Target: RNASEH2A (Ribonuclease H2, Subunit A (RNASEH2A))

Reactivity: Human, Zebrafish (Danio rerio)

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RNASEH2A antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-RNASEH2A Antibody

Binding Specificity: Middle Region

Specificity: RNASEH2 A antibody was raised against the middle region of RNASEH2

Purification: Purified

Immunogen: RNASEH2 A antibody was raised using the middle region of RNASEH2 corresponding to a region with amino acids AQTILEKEAEDVIWEDSASENQEGLRKITSYFLNEGSQARPRSSHRYFLE

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RNASEH2A Blocking Peptide, (ABIN936844), is also available for use as a blocking control in assays to test for specificity of this RNASEH2A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNASEH0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RNASEH2A

Target: RNASEH2A (Ribonuclease H2, Subunit A (RNASEH2A))

Alternative Name: RNASEH2A

Background: Of the multiple RNases H in mammals, RNase HI is the major enzyme and shows increased activity during DNA replication. It shows more homology to the RNase HII of Escherichia coli.Of the multiple RNases H in mammals, RNase HI is the major enzyme and shows increased activity during DNA replication. It shows more homology to the RNase HII of Escherichia coli.

Molecular Weight: 33 kDa (MW of target protein)