PIK3CB antibody (C-Term)

Catalog No. ABIN630206

The Rabbit Polyclonal anti-PIK3CB antibody has been validated for WB. It is suitable to detect PIK3CB in samples from Human, Mouse, Rat and Dog.

Quick Overview for PIK3CB antibody (C-Term) (ABIN630206)

Target: PIK3CB (Phosphoinositide-3-Kinase, Catalytic, beta Polypeptide (PIK3CB))

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PIK3CB antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-PIK3CB Antibody

Binding Specificity: C-Term

Specificity: PIK3 CB antibody was raised against the C terminal of PIK3 B

Purification: Purified

Immunogen: PIK3 CB antibody was raised using the C terminal of PIK3 B corresponding to a region with amino acids VKDIQYLKDSLALGKSEEEALKQFKQKFDEALRESWTTKVNWMAHTVRKD

Application Details

Application Notes: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PIK3CB Blocking Peptide, (ABIN5615375), is also available for use as a blocking control in assays to test for specificity of this PIK3CB antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PIK0 B antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PIK3CB

Target: PIK3CB (Phosphoinositide-3-Kinase, Catalytic, beta Polypeptide (PIK3CB))

Alternative Name: PIK3CB

Background: Phosphoinositide 3-kinases (PI3Ks) phosphorylate the 3-prime OH position of the inositol ring of inositol lipids. They have been implicated as participants in signaling pathways regulating cell growth by virtue of their activation in response to various mitogenic stimuli. PI3Ks are composed of a 110 kDa catalytic subunit, such as PIK3CB, and an 85 kDa adaptor subunit.

Molecular Weight: 123 kDa (MW of target protein)