MSH2 antibody

Catalog No. ABIN630207

This anti-MSH2 antibody is a Rabbit Polyclonal antibody detecting MSH2 in WB. Suitable for Human, Rat, Dog and Zebrafish (Danio rerio).

Quick Overview for MSH2 antibody (ABIN630207)

Target: MSH2 (Mismatch Repair Protein 2 (MSH2))

Reactivity: Human, Rat, Dog, Zebrafish (Danio rerio)

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MSH2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-MSH2 Antibody

Purification: Purified

Immunogen: MSH2 antibody was raised using a synthetic peptide corresponding to a region with amino acids KMSAVDGQRQVGVGYVDSIQRKLGLCEFPDNDQFSNLEALLIQIGPKECV

Application Details

Application Notes: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MSH2 Blocking Peptide, (ABIN939948), is also available for use as a blocking control in assays to test for specificity of this MSH2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MSH2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MSH2

Target: MSH2 (Mismatch Repair Protein 2 (MSH2))

Alternative Name: MSH2

Background: MSH2 was identified as a locus frequently mutated in hereditary nonpolyposis colon cancer (HNPCC). When cloned, it was discovered to be a human homolog of the E. coli mismatch repair gene mutS, consistent with the characteristic alterations in microsatellite sequences (RER+ phenotype) found in HNPCC.

Molecular Weight: 64 kDa (MW of target protein)

Pathways: DNA Damage Repair, Production of Molecular Mediator of Immune Response