PAGE1 antibody

Catalog No. ABIN630210

This anti-PAGE1 antibody is a Rabbit Polyclonal antibody detecting PAGE1 in WB. Suitable for Human.

Quick Overview for PAGE1 antibody (ABIN630210)

Target: PAGE1 (P Antigen Family, Member 1 (Prostate Associated) (PAGE1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PAGE1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-PAGE1 Antibody

Purification: Purified

Immunogen: PAGE1 antibody was raised using a synthetic peptide corresponding to a region with amino acids TKRVCLRNEEQMKLPAEGPEPEADSQEQVHPKTGCERGDGPDVQELGLPN

Application Details

Application Notes: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PAGE1 Blocking Peptide, (ABIN5615192), is also available for use as a blocking control in assays to test for specificity of this PAGE1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PAGE1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PAGE1

Target: PAGE1 (P Antigen Family, Member 1 (Prostate Associated) (PAGE1))

Alternative Name: PAGE1

Background: PAGE1 belongs to a family that are expressed in a variety of tumors but not in normal tissues, except for the testis. Nothing is presently known about the function of this protein.

Molecular Weight: 16 kDa (MW of target protein)