G3BP1 antibody (N-Term)

Catalog No. ABIN630227

The Rabbit Polyclonal anti-G3BP1 antibody is suitable to detect G3BP1 in samples from Human, Mouse and Dog. It has been validated for WB.

Quick Overview for G3BP1 antibody (N-Term) (ABIN630227)

Target: G3BP1 (GTPase Activating Protein (SH3 Domain) Binding Protein 1 (G3BP1))

Reactivity: Human, Mouse, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This G3BP1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-G3BP1 Antibody

Binding Specificity: N-Term

Specificity: G3 BP antibody was raised against the N terminal Of G3 p

Purification: Purified

Immunogen: G3 BP antibody was raised using the N terminal Of G3 p corresponding to a region with amino acids EVFGGFVTEPQEESEEEVEEPEERQQTPEVVPDDSGTFYDQAVVSNDMEE

Application Details

Application Notes: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

G3BP Blocking Peptide, (ABIN938171), is also available for use as a blocking control in assays to test for specificity of this G3BP antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of G0 P antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for G3BP1

Target: G3BP1 (GTPase Activating Protein (SH3 Domain) Binding Protein 1 (G3BP1))

Alternative Name: G3BP

Background: G3BP is one of the DNA-unwinding enzymes which prefers partially unwound 3'-tailed substrates and can also unwind partial RNA/DNA and RNA/RNA duplexes in an ATP-dependent fashion. This enzyme is a member of the heterogeneous nuclear RNA-binding proteins and is also an element of the Ras signal transduction pathway. It binds specifically to the Ras-GTPase-activating protein by associating with its SH3 domain. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined.

Molecular Weight: 51 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interactome