SLC39A6 antibody

Catalog No. ABIN630293

Product Details anti-SLC39A6 Antibody

Target: SLC39A6 (Solute Carrier Family 39 (Zinc Transporter), Member 6 (SLC39A6))

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLC39A6 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Purified

Immunogen: SLC39 A6 antibody was raised using a synthetic peptide corresponding to a region with amino acids RSCLIHTSEKKAEIPPKTYSLQIAWVGGFIAISIISFLSLLGVILVPLMN

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC39A6 Blocking Peptide, catalog no. 33R-8173, is also available for use as a blocking control in assays to test for specificity of this SLC39A6 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SLC39A6

Target: SLC39A6 (Solute Carrier Family 39 (Zinc Transporter), Member 6 (SLC39A6))

Alternative Name: SLC39A6 (SLC39A6 Products)

Synonyms: liv1 antibody, wu:fc25a09 antibody, ZIP6 antibody, Ermelin antibody, LIV-1 antibody, solute carrier family 39 (zinc transporter), member 6 antibody, solute carrier family 39 member 6 antibody, solute carrier family 39 (metal ion transporter), member 6 antibody, slc39a6 antibody, SLC39A6 antibody, Slc39a6 antibody

Background: Zinc is an essential cofactor for hundreds of enzymes. It is involved in protein, nucleic acid, carbohydrate, and lipid metabolism, as well as in the control of gene transcription, growth, development, and differentiation. SLC39A6 belongs to a subfamily of proteins that show structural characteristics of zinc transporters.

Molecular Weight: 48 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis