SLC6A18 antibody (Middle Region)

Catalog No. ABIN630375

Product Details anti-SLC6A18 Antibody

Target: SLC6A18 (Solute Carrier Family 6, Member 18 (SLC6A18))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLC6A18 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: SLC6 A18 antibody was raised against the middle region of SLC6 18

Purification: Purified

Immunogen: SLC6 A18 antibody was raised using the middle region of SLC6 18 corresponding to a region with amino acids MHLNATWPKRVAQLPLKACLLEDFLDKSASGPGLAFVVFTETDLHMPGAP

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC6A18 Blocking Peptide, catalog no. 33R-6097, is also available for use as a blocking control in assays to test for specificity of this SLC6A18 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC0 18 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SLC6A18

Target: SLC6A18 (Solute Carrier Family 6, Member 18 (SLC6A18))

Alternative Name: SLC6A18 (SLC6A18 Products)

Synonyms: SLC6A18 antibody, zgc:172267 antibody, B0AT3 antibody, D630001K16Rik antibody, Xt2 antibody, Xtrp2 antibody, Rosit antibody, solute carrier family 6 member 18 antibody, solute carrier family 6 (neutral amino acid transporter), member 18 antibody, solute carrier family 6 (neurotransmitter transporter), member 18 antibody, solute carrier family 6, member 18 antibody, SLC6A18 antibody, slc6a18 antibody, Slc6a18 antibody

Background: The SLC6 family of proteins, which includes SLC6A18, acts as specific transporters for neurotransmitters, amino acids, and osmolytes like betaine, taurine, and creatine. SLC6 proteins are sodium cotransporters that derive the energy for solute transport from the electrochemical gradient for sodium ions.

Molecular Weight: 69 kDa (MW of target protein)