UNC93B1 antibody

Catalog No. ABIN630393

Product Details anti-UNC93B1 Antibody

Target: UNC93B1 (Unc-93 Homolog B1 (UNC93B1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This UNC93B1 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Purified

Immunogen: UNC93 B1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LKNVLAASAGGMLTYGVYLGLLQMQLILHYDETYREVKYGNMGLPDIDSK

Application Details

Application Notes: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

UNC93B1 Blocking Peptide, catalog no. 33R-5095, is also available for use as a blocking control in assays to test for specificity of this UNC93B1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UNC90 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for UNC93B1

Target: UNC93B1 (Unc-93 Homolog B1 (UNC93B1))

Alternative Name: UNC93B1 (UNC93B1 Products)

Synonyms: UNC93 antibody, IIAE1 antibody, UNC93B antibody, Unc-93B1 antibody, Unc93b antibody, unc-93 homolog B1, TLR signaling regulator antibody, unc-93 homolog B1 (C. elegans) antibody, UNC93B1 antibody, Unc93b1 antibody

Background: UNC93B1 is a protein with similarity to the C. elegans unc93 protein. The Unc93 protein is involved in the regulation or coordination of muscle contraction in the worm.

Molecular Weight: 67 kDa (MW of target protein)

Pathways: TLR Signaling, Activation of Innate immune Response, Toll-Like Receptors Cascades