M6PR antibody

Catalog No. ABIN630460

Product Details anti-M6PR Antibody

Target: M6PR (Mannose-6-Phosphate Receptor (Cation Dependent) (M6PR))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This M6PR antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Purified

Immunogen: M6 PR antibody was raised using a synthetic peptide corresponding to a region with amino acids RLKPLFNKSFESTVGQGSDTYIYIFRVCREAGNHTSGAGLVQINKSNGKE

Application Details

Application Notes: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

M6PR Blocking Peptide, catalog no. 33R-8035, is also available for use as a blocking control in assays to test for specificity of this M6PR antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of M0 R antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for M6PR

Target: M6PR (Mannose-6-Phosphate Receptor (Cation Dependent) (M6PR))

Alternative Name: M6PR (M6PR Products)

Background: M6PR is a receptor for mannose-6-phosphate groups on lysosomal enzymes. The receptor forms a homodimer or homotetramer for intracellular targeting of lysosomal enzymes and export of newly synthesized lysosomal enzymes into the cell secretions. The receptor is an integral membrane protein which localizes to the trans-Golgi reticulum, endosomes, and the plasma membrane.

Molecular Weight: 28 kDa (MW of target protein)