Melanoma gp100 antibody

Catalog No. ABIN630469

This Rabbit Polyclonal antibody specifically detects Melanoma gp100 in IHC and WB. It exhibits reactivity toward Human, Rat and Mouse.

Quick Overview for Melanoma gp100 antibody (ABIN630469)

Target: Melanoma gp100 (PMEL) (Premelanosome Protein (PMEL))

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Melanoma gp100 antibody is un-conjugated

Application: Immunohistochemistry (IHC), Western Blotting (WB)

Product Details anti-Melanoma gp100 Antibody

Purification: Purified

Immunogen: SILV antibody was raised using a synthetic peptide corresponding to a region with amino acids HFLRNQPLTFALQLHDPSGYLAEADLSYTWDFGDSSGTLISRALVVTHTY

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SILV Blocking Peptide, (ABIN939113), is also available for use as a blocking control in assays to test for specificity of this SILV antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SILV antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Melanoma gp100

Target: Melanoma gp100 (PMEL) (Premelanosome Protein (PMEL))

Alternative Name: SILV

Background: SILV could be a melanogenic enzyme. It could represent an oncofetal self-antigen that is normally expressed at low levels in quiescent adult melanocytes but overexpressed by proliferating neonatal melanocytes and during tumor growth. Release of the soluble form, ME20-S, it could protect tumor cells from antibody mediated immunity.

Molecular Weight: 70 kDa (MW of target protein)