NR1D1 antibody (Middle Region)

Catalog No. ABIN630499

This Rabbit Polyclonal antibody specifically detects NR1D1 in WB. It exhibits reactivity toward Human and Rat.

Quick Overview for NR1D1 antibody (Middle Region) (ABIN630499)

Target: NR1D1 (Nuclear Receptor Subfamily 1, Group D, Member 1 (NR1D1))

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NR1D1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-NR1D1 Antibody

Binding Specificity: Middle Region

Specificity: NR1 D1 antibody was raised against the middle region of NR1 1

Purification: Affinity purified

Immunogen: NR1 D1 antibody was raised using the middle region of NR1 1 corresponding to a region with amino acids SQVARAHREIFTYAHDKLGSSPGNFNANHASGSPPATTPHRWENQGCPPA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NR1D1 Blocking Peptide, (ABIN5615045), is also available for use as a blocking control in assays to test for specificity of this NR1D1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NR0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NR1D1

Target: NR1D1 (Nuclear Receptor Subfamily 1, Group D, Member 1 (NR1D1))

Alternative Name: NR1D1

Background: NR1D1 belongs to the nuclear hormone receptor family, NR1 subfamily. It contains 1 nuclear receptor DNA-binding domain. NR1D1 functions as a constitutive transcriptional repressor. It is a possible receptor for triiodothyronine.

Molecular Weight: 67 kDa (MW of target protein)

Pathways: Nuclear Receptor Transcription Pathway, Steroid Hormone Mediated Signaling Pathway, Cellular Response to Molecule of Bacterial Origin, Regulation of Lipid Metabolism by PPARalpha