NR1H4 antibody (Middle Region)

Catalog No. ABIN630514

This Rabbit Polyclonal antibody specifically detects NR1H4 in WB. It exhibits reactivity toward Human.

Quick Overview for NR1H4 antibody (Middle Region) (ABIN630514)

Target: NR1H4 (Nuclear Receptor Subfamily 1, Group H, Member 4 (NR1H4))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NR1H4 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-NR1H4 Antibody

Binding Specificity: Middle Region

Specificity: NR1 H4 antibody was raised against the middle region of NR1 4

Purification: Affinity purified

Immunogen: NR1 H4 antibody was raised using the middle region of NR1 4 corresponding to a region with amino acids SAVEAMFLRSAEIFNKKLPSGHSDLLEERIRNSGISDEYITPMFSFYKSI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NR1H4 Blocking Peptide, (ABIN5615047), is also available for use as a blocking control in assays to test for specificity of this NR1H4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NR0 4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NR1H4

Target: NR1H4 (Nuclear Receptor Subfamily 1, Group H, Member 4 (NR1H4))

Alternative Name: NR1H4

Background: NR1H4 is the receptor for bile acids such as chenodeoxycholic acid, lithocholic acid and deoxycholic acid. NR1H4 represses the transcription of the cholesterol 7-alpha-hydroxylase gene (CYP7A1) through the induction of NR0B2 or FGF19 expression.

Molecular Weight: 54 kDa (MW of target protein)

Pathways: Nuclear Receptor Transcription Pathway, Steroid Hormone Mediated Signaling Pathway, Regulation of Carbohydrate Metabolic Process