NR1H4 antibody (Middle Region)
-
- Target See all NR1H4 Antibodies
- NR1H4 (Nuclear Receptor Subfamily 1, Group H, Member 4 (NR1H4))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This NR1H4 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- NR1 H4 antibody was raised against the middle region of NR1 4
- Purification
- Affinity purified
- Immunogen
- NR1 H4 antibody was raised using the middle region of NR1 4 corresponding to a region with amino acids SAVEAMFLRSAEIFNKKLPSGHSDLLEERIRNSGISDEYITPMFSFYKSI
- Top Product
- Discover our top product NR1H4 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
NR1H4 Blocking Peptide, catalog no. 33R-8322, is also available for use as a blocking control in assays to test for specificity of this NR1H4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NR0 4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NR1H4 (Nuclear Receptor Subfamily 1, Group H, Member 4 (NR1H4))
- Alternative Name
- NR1H4 (NR1H4 Products)
- Background
- NR1H4 is the receptor for bile acids such as chenodeoxycholic acid, lithocholic acid and deoxycholic acid. NR1H4 represses the transcription of the cholesterol 7-alpha-hydroxylase gene (CYP7A1) through the induction of NR0B2 or FGF19 expression.
- Molecular Weight
- 54 kDa (MW of target protein)
- Pathways
- Nuclear Receptor Transcription Pathway, Steroid Hormone Mediated Signaling Pathway, Regulation of Carbohydrate Metabolic Process
-