YTHDF1 antibody (Middle Region)

Catalog No. ABIN630562

This Rabbit Polyclonal antibody specifically detects YTHDF1 in WB. It exhibits reactivity toward Human.

Quick Overview for YTHDF1 antibody (Middle Region) (ABIN630562)

Target: YTHDF1 (YTH Domain Family, Member 1 (YTHDF1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This YTHDF1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-YTHDF1 Antibody

Binding Specificity: Middle Region

Specificity: YTHDF1 antibody was raised against the middle region of YTHDF1

Purification: Affinity purified

Immunogen: YTHDF1 antibody was raised using the middle region of YTHDF1 corresponding to a region with amino acids QQAPSPQAAPQPQQVAQPLPAQPPALAQPQYQSPQQPPQTRWVAPRNRNA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

YTHDF1 Blocking Peptide, (ABIN5617061), is also available for use as a blocking control in assays to test for specificity of this YTHDF1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of YTHDF1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for YTHDF1

Target: YTHDF1 (YTH Domain Family, Member 1 (YTHDF1))

Alternative Name: YTHDF1

Background: The function of YTHDF1 protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 61 kDa (MW of target protein)