Tryptophan Hydroxylase 2 antibody (Middle Region)

Catalog No. ABIN630578

The Rabbit Polyclonal anti-Tryptophan Hydroxylase 2 antibody has been validated for WB. It is suitable to detect Tryptophan Hydroxylase 2 in samples from Human, Rat and Mouse.

Quick Overview for Tryptophan Hydroxylase 2 antibody (Middle Region) (ABIN630578)

Target: Tryptophan Hydroxylase 2 (TPH2)

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Tryptophan Hydroxylase 2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Tryptophan Hydroxylase 2 Antibody

Binding Specificity: Middle Region

Specificity: TPH2 antibody was raised against the middle region of TPH2

Purification: Affinity purified

Immunogen: TPH2 antibody was raised using the middle region of TPH2 corresponding to a region with amino acids KMRDFAKSITRPFSVYFNPYTQSIEILKDTRSIENVVQDLRSDLNTVCDA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TPH2 Blocking Peptide, (ABIN939947), is also available for use as a blocking control in assays to test for specificity of this TPH2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TPH2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Tryptophan Hydroxylase 2

Target: Tryptophan Hydroxylase 2 (TPH2)

Alternative Name: TPH2

Background: Tryptophan hydroxylase (TPH, EC 1.14.16.4) is the rate-limiting enzyme in the synthesis of serotonin (5-hydroxytryptamine, or 5HT). 5HT is causally involved in numerous central nervous activities, and it has several functions in peripheral tissues, including the maintenance of vascular tone and gut motility.

Molecular Weight: 56 kDa (MW of target protein)