Tryptophan Hydroxylase 2 antibody (Middle Region)
-
- Target See all Tryptophan Hydroxylase 2 (TPH2) Antibodies
- Tryptophan Hydroxylase 2 (TPH2)
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Rat, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Tryptophan Hydroxylase 2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- TPH2 antibody was raised against the middle region of TPH2
- Purification
- Affinity purified
- Immunogen
- TPH2 antibody was raised using the middle region of TPH2 corresponding to a region with amino acids KMRDFAKSITRPFSVYFNPYTQSIEILKDTRSIENVVQDLRSDLNTVCDA
- Top Product
- Discover our top product TPH2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
TPH2 Blocking Peptide, catalog no. 33R-4561, is also available for use as a blocking control in assays to test for specificity of this TPH2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TPH2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Tryptophan Hydroxylase 2 (TPH2)
- Alternative Name
- TPH2 (TPH2 Products)
- Background
- Tryptophan hydroxylase (TPH, EC 1.14.16.4) is the rate-limiting enzyme in the synthesis of serotonin (5-hydroxytryptamine, or 5HT). 5HT is causally involved in numerous central nervous activities, and it has several functions in peripheral tissues, including the maintenance of vascular tone and gut motility.
- Molecular Weight
- 56 kDa (MW of target protein)
-