TRIM54 antibody (N-Term)

Catalog No. ABIN630592

Product Details anti-TRIM54 Antibody

Target: TRIM54 (Tripartite Motif Containing 54 (TRIM54))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TRIM54 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TRIM54 antibody was raised against the N terminal of TRIM54

Purification: Affinity purified

Immunogen: TRIM54 antibody was raised using the N terminal of TRIM54 corresponding to a region with amino acids NFTVGFKPLLGDAHSMDNLEKQLICPICLEMFSKPVVILPCQHNLCRKCA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TRIM54 Blocking Peptide, catalog no. 33R-6692, is also available for use as a blocking control in assays to test for specificity of this TRIM54 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRIM54 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TRIM54

Target: TRIM54 (Tripartite Motif Containing 54 (TRIM54))

Alternative Name: TRIM54 (TRIM54 Products)

Synonyms: MGC80214 antibody, si:dkey-221h15.2 antibody, DKFZp468L1522 antibody, MURF antibody, MURF-3 antibody, RNF30 antibody, muRF3 antibody, 4930486E09Rik antibody, 4930566I02Rik antibody, MuRF3 antibody, Rnf30 antibody, tripartite motif containing 54 antibody, tripartite motif containing 54 S homeolog antibody, tripartite motif-containing 54 antibody, TRIM54 antibody, trim54.S antibody, trim54 antibody, Trim54 antibody

Background: TRIM54 contains a RING finger motif and is highly similar to the ring finger proteins RNF28/MURF1 and RNF29/MURF2. In vitro studies demonstrated that this protein, RNF28, and RNF29 form heterodimers, which may be important for the regulation of titin kinase and microtubule-dependent signal pathways in striated muscles.

Molecular Weight: 45 kDa (MW of target protein)