TXNIP antibody (C-Term)

Catalog No. ABIN630604

This Rabbit Polyclonal antibody specifically detects TXNIP in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for TXNIP antibody (C-Term) (ABIN630604)

Target: TXNIP (Thioredoxin Interacting Protein (TXNIP))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TXNIP antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-TXNIP Antibody

Binding Specificity: C-Term

Specificity: TXNIP antibody was raised against the C terminal of TXNIP

Purification: Affinity purified

Immunogen: TXNIP antibody was raised using the C terminal of TXNIP corresponding to a region with amino acids DTPEAPPCYMDVIPEDHRLESPTTPLLDDMDGSQDSPIFMYAPEFKFMPP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TXNIP Blocking Peptide, (ABIN937587), is also available for use as a blocking control in assays to test for specificity of this TXNIP antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TXNIP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TXNIP

Target: TXNIP (Thioredoxin Interacting Protein (TXNIP))

Alternative Name: TXNIP

Background: TXNIP may act as an oxidative stress mediator by inhibiting thioredoxin activity or by limiting its bioavailability. It interacts with COPS5 and restores COPS5-induced suppression of CDKN1B stability, blocking the COPS5-mediated translocation of CDKN1B from the nucleus to the cytoplasm. It functions as a transcriptional repressor, possibly by acting as a bridge molecule between transcription factors and corepressor complexes, and over-expression will induce G0/G1 cell cycle arrest. It is required for the maturation of natural killer cells.

Molecular Weight: 44 kDa (MW of target protein)

Pathways: Protein targeting to Nucleus, Platelet-derived growth Factor Receptor Signaling, Inflammasome