ACTR1B antibody
-
- Target See all ACTR1B Antibodies
- ACTR1B (ARP1 Actin-Related Protein 1 Homolog B, Centractin beta (ACTR1B))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ACTR1B antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- ACTR1 B antibody was raised using a synthetic peptide corresponding to a region with amino acids KIKISAPQERLYSTWIGGSILASLDTFKKMWVSKKEYEEDGSRAIHRKTF
- Top Product
- Discover our top product ACTR1B Primary Antibody
-
-
- Application Notes
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ACTR1B Blocking Peptide, catalog no. 33R-4434, is also available for use as a blocking control in assays to test for specificity of this ACTR1B antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACTR0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ACTR1B (ARP1 Actin-Related Protein 1 Homolog B, Centractin beta (ACTR1B))
- Alternative Name
- ACTR1B (ACTR1B Products)
- Background
- ACTR1B is a 42.3 kDa subunit of dynactin, a macromolecular complex consisting of 10 subunits ranging in size from 22 to 150 kDa. Dynactin binds to both microtubules and cytoplasmic dynein and is involved in a diverse array of cellular functions, including ER-to-Golgi transport, the centripetal movement of lysosomes and endosomes, spindle formation, chromosome movement, nuclear positioning, and axonogenesis.
- Molecular Weight
- 42 kDa (MW of target protein)
-