SMUG1 antibody (Middle Region)

Catalog No. ABIN630668

Product Details anti-SMUG1 Antibody

Target: SMUG1 (Single-Strand-Selective Monofunctional Uracil-DNA Glycosylase 1 (SMUG1))

Binding Specificity: Middle Region

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SMUG1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SMUG1 antibody was raised against the middle region of SMUG1

Purification: Affinity purified

Immunogen: SMUG1 antibody was raised using the middle region of SMUG1 corresponding to a region with amino acids IVGPVLTPPQEHPKRPVLGLECPQSEVSGARFWGFFRNLCGQPEVFFHHC

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SMUG1 Blocking Peptide, catalog no. 33R-4200, is also available for use as a blocking control in assays to test for specificity of this SMUG1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SMUG1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SMUG1

Target: SMUG1 (Single-Strand-Selective Monofunctional Uracil-DNA Glycosylase 1 (SMUG1))

Alternative Name: SMUG1 (SMUG1 Products)

Synonyms: SMUG1 antibody, xsmug1 antibody, 1200013B09Rik antibody, A930006H09Rik antibody, C85220 antibody, FDG antibody, HMUDG antibody, UNG3 antibody, single-strand-selective monofunctional uracil-DNA glycosylase 1 antibody, single-strand selective monofunctional uracil DNA glycosylase antibody, single-strand-selective monofunctional uracil-DNA glycosylase 1 L homeolog antibody, SMUG1 antibody, smug1 antibody, smuG1 antibody, smuG antibody, LOC5577584 antibody, CpipJ_CPIJ002767 antibody, Smug1 antibody, smug1.L antibody

Background: SMUG1 is a glycosylase that removes uracil from single- and double-stranded DNA in nuclear chromatin, thus contributing to base excision repair.

Molecular Weight: 30 kDa (MW of target protein)

Pathways: DNA Damage Repair