CDYL antibody (N-Term)

Catalog No. ABIN630672

This anti-CDYL antibody is a Rabbit Polyclonal antibody detecting CDYL in WB. Suitable for Human.

Quick Overview for CDYL antibody (N-Term) (ABIN630672)

Target: CDYL (Chromodomain Protein, Y-Like (CDYL))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CDYL antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-CDYL Antibody

Binding Specificity: N-Term

Specificity: CDYL antibody was raised against the n terminal of CDYL

Purification: Affinity purified

Immunogen: CDYL antibody was raised using the N terminal of CDYL corresponding to a region with amino acids YIHDFNRRHTEKQKESTLTRTNRTSPNNARKQISRSTNSNFSKTSPKALV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CDYL Blocking Peptide, (ABIN936102), is also available for use as a blocking control in assays to test for specificity of this CDYL antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CDYL antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CDYL

Target: CDYL (Chromodomain Protein, Y-Like (CDYL))

Alternative Name: CDYL

Background: CDYL acts as repressor of transcription. CDYL has histone acetyltransferase activity, with a preference for histone H4.Chromodomain Y is a primate-specific Y-chromosomal gene family expressed exclusively in the testis and implicated in infertility. Although the Y-linked genes are testis-specific, this autosomal gene is ubiquitously expressed. The Y-linked genes arose by retrotransposition of an mRNA from this gene, followed by amplification of the retroposed gene.

Molecular Weight: 60 kDa (MW of target protein)