PIM1 antibody (N-Term)

Catalog No. ABIN630674

The Rabbit Polyclonal anti-PIM1 antibody has been validated for WB. It is suitable to detect PIM1 in samples from Human, Mouse and Rat.

Quick Overview for PIM1 antibody (N-Term) (ABIN630674)

Target: PIM1 (Pim-1 Oncogene (PIM1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PIM1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-PIM1 Antibody

Binding Specificity: N-Term

Specificity: PIM1 antibody was raised against the N terminal of PIM1

Purification: Affinity purified

Immunogen: PIM1 antibody was raised using the N terminal of PIM1 corresponding to a region with amino acids MLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PIM1 Blocking Peptide, (ABIN5615379), is also available for use as a blocking control in assays to test for specificity of this PIM1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PIM1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PIM1

Target: PIM1 (Pim-1 Oncogene (PIM1))

Alternative Name: PIM1

Background: PIM1 may affect the structure or silencing of chromatin by phosphorylating HP1 gamma/CBX3. Isoform 2 promotes the G1/S transition of the cell cycle via up-regulation of CDK2 activity and phosphorylation of CDKN1B.

Molecular Weight: 36 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process