PIM1 antibody (N-Term)
-
- Target See all PIM1 Antibodies
- PIM1 (Pim-1 Oncogene (PIM1))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PIM1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- PIM1 antibody was raised against the N terminal of PIM1
- Purification
- Affinity purified
- Immunogen
- PIM1 antibody was raised using the N terminal of PIM1 corresponding to a region with amino acids MLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFG
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PIM1 Blocking Peptide, catalog no. 33R-6196, is also available for use as a blocking control in assays to test for specificity of this PIM1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PIM1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PIM1 (Pim-1 Oncogene (PIM1))
- Alternative Name
- PIM1 (PIM1 Products)
- Synonyms
- PIM antibody, Pim-1 antibody, PIM1 antibody, pim antibody, pim-1 antibody, pim3 antibody, Pim-1 proto-oncogene, serine/threonine kinase antibody, proviral integration site 1 antibody, Pim-1 proto-oncogene, serine/threonine kinase L homeolog antibody, PIM1 antibody, Pim1 antibody, pim1 antibody, pim1.L antibody
- Background
- PIM1 may affect the structure or silencing of chromatin by phosphorylating HP1 gamma/CBX3. Isoform 2 promotes the G1/S transition of the cell cycle via up-regulation of CDK2 activity and phosphorylation of CDKN1B.
- Molecular Weight
- 36 kDa (MW of target protein)
- Pathways
- Glycosaminoglycan Metabolic Process
-