GTDC1 antibody (N-Term)

Catalog No. ABIN630762

Product Details anti-GTDC1 Antibody

Target: GTDC1 (Glycosyltransferase-Like Domain Containing 1 (GTDC1))

Binding Specificity: N-Term

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GTDC1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: GTDC1 antibody was raised against the N terminal of GTDC1

Purification: Affinity purified

Immunogen: GTDC1 antibody was raised using the N terminal of GTDC1 corresponding to a region with amino acids CQERDFQYGYNQILSCLVADVVVFNSVFNMESFLTSMGKFMKLIPDHRPK

Application Details

Application Notes: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GTDC1 Blocking Peptide, catalog no. 33R-1780, is also available for use as a blocking control in assays to test for specificity of this GTDC1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GTDC1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GTDC1

Target: GTDC1 (Glycosyltransferase-Like Domain Containing 1 (GTDC1))

Alternative Name: GTDC1 (GTDC1 Products)

Synonyms: Hmat-Xa antibody, mat-Xa antibody, E330008O22Rik antibody, zgc:110568 antibody, glycosyltransferase like domain containing 1 antibody, glycosyltransferase-like domain containing 1 antibody, glycosyltransferase like domain containing 1 S homeolog antibody, GTDC1 antibody, Gtdc1 antibody, gtdc1.S antibody, gtdc1 antibody

Background: The function of GTDC1 protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 52 kDa (MW of target protein)