LAT2 antibody (N-Term)
-
- Target See all LAT2 Antibodies
- LAT2 (Linker For Activation of T Cells Family, Member 2 (LAT2))
-
Binding Specificity
- N-Term
-
Reactivity
- Drosophila melanogaster
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This LAT2 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificity
- LAB antibody was raised against the N terminal Of Lab
- Purification
- Affinity purified
- Immunogen
- LAB antibody was raised using the N terminal Of Lab corresponding to a region with amino acids MMDVSSMYGNHPHHHHPHANAYDGYSTTTASAANASSYFAPQQHQPHLQL
- Top Product
- Discover our top product LAT2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
LAB Blocking Peptide, catalog no. 33R-6229, is also available for use as a blocking control in assays to test for specificity of this LAB antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LAB antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- LAT2 (Linker For Activation of T Cells Family, Member 2 (LAT2))
- Alternative Name
- LAB (LAT2 Products)
- Background
- Lab is a sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. It is required for proper head development.
- Molecular Weight
- 54 kDa (MW of target protein)
- Pathways
- Fc-epsilon Receptor Signaling Pathway, BCR Signaling
-