LAT2 antibody (N-Term)

Catalog No. ABIN630764

Product Details anti-LAT2 Antibody

Target: LAT2 (Linker For Activation of T Cells Family, Member 2 (LAT2))

Binding Specificity: N-Term

Reactivity: Drosophila melanogaster

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LAT2 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: LAB antibody was raised against the N terminal Of Lab

Purification: Affinity purified

Immunogen: LAB antibody was raised using the N terminal Of Lab corresponding to a region with amino acids MMDVSSMYGNHPHHHHPHANAYDGYSTTTASAANASSYFAPQQHQPHLQL

Application Details

Application Notes: WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LAB Blocking Peptide, catalog no. 33R-6229, is also available for use as a blocking control in assays to test for specificity of this LAB antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LAB antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LAT2

Target: LAT2 (Linker For Activation of T Cells Family, Member 2 (LAT2))

Alternative Name: LAB (LAT2 Products)

Synonyms: LAB antibody, NTAL antibody, WBSCR15 antibody, WBSCR5 antibody, WSCR5 antibody, LAT2 antibody, MGC139435 antibody, Ntal antibody, Wbscr5 antibody, AW125574 antibody, Wbscr15 antibody, linker for activation of T-cells family member 2 antibody, linker for activation of T cells family, member 2 antibody, LAT2 antibody, Lat2 antibody

Background: Lab is a sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. It is required for proper head development.

Molecular Weight: 54 kDa (MW of target protein)

Pathways: Fc-epsilon Receptor Signaling Pathway, BCR Signaling