Fibronectin 1 antibody (C-Term)

Catalog No. ABIN630804

This anti-Fibronectin 1 antibody is a Rabbit Polyclonal antibody detecting Fibronectin 1 in WB. Suitable for Human and Dog.

Quick Overview for Fibronectin 1 antibody (C-Term) (ABIN630804)

Target: Fibronectin 1 (FN1)

Reactivity: Human, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Fibronectin 1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Fibronectin 1 Antibody

Binding Specificity: C-Term

Specificity: Fibronectin 1 antibody was raised against the C terminal of FN1

Purification: Affinity purified

Immunogen: Fibronectin 1 antibody was raised using the C terminal of FN1 corresponding to a region with amino acids NCRRPGGEPSPEGTTGQSYNQYSQRYHQRTNTNVNCPIECFMPLDVQADR

Application Details

Application Notes: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Fibronectin 1 Blocking Peptide, (ABIN5613589), is also available for use as a blocking control in assays to test for specificity of this Fibronectin 1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FN1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Fibronectin 1

Target: Fibronectin 1 (FN1)

Alternative Name: Fibronectin 1

Background: FN1 is a glycoprotein present in a soluble dimeric form in plasma, and in a dimeric or multimeric form at the cell surface and in extracellular matrix. Fibronectin is involved in cell adhesion and migration processes including embryogenesis, wound healing, blood coagulation, host defense, and metastasis.

Molecular Weight: 76 kDa (MW of target protein)

Pathways: Cellular Response to Molecule of Bacterial Origin, Carbohydrate Homeostasis, Autophagy