HAL antibody (N-Term)

Catalog No. ABIN630816

Product Details anti-HAL Antibody

Target: HAL (Histidine Ammonia-Lyase (HAL))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HAL antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: HAL antibody was raised against the N terminal of HAL

Purification: Affinity purified

Immunogen: HAL antibody was raised using the N terminal of HAL corresponding to a region with amino acids INKLQELQVNLVRSHSSGVGKPLSPERCRMLLALRINVLAKGYSGISLET

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

HAL Blocking Peptide, catalog no. 33R-4075, is also available for use as a blocking control in assays to test for specificity of this HAL antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HAL antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for HAL

Target: HAL (Histidine Ammonia-Lyase (HAL))

Alternative Name: HAL (HAL Products)

Synonyms: HIS antibody, HSTD antibody, hal antibody, hstd antibody, xhal antibody, HAL antibody, BA3712 antibody, DDBDRAFT_0187742 antibody, DDBDRAFT_0231727 antibody, DDB_0187742 antibody, DDB_0231727 antibody, zgc:136980 antibody, his antibody, Hsd antibody, histidase antibody, histidine ammonia-lyase antibody, histidine ammonia-lyase, gene 1 L homeolog antibody, histidine ammonia-lyase HutH antibody, histidine ammonia-lyase, gene 1 antibody, histidine ammonia lyase antibody, HAL antibody, hal.1.L antibody, hutH antibody, Tc00.1047053506247.220 antibody, Plav_1493 antibody, hal antibody, hal.1 antibody, Hal antibody

Background: HAL is a cytosolic enzyme catalyzing the first reaction in histidine catabolism, the nonoxidative deamination of L-histidine to trans-urocanic acid. HAL defects cause histidinemia which is characterized by increased histidine and histamine and decreased urocanic acid in body fluids.

Molecular Weight: 72 kDa (MW of target protein)