Peroxiredoxin 1 antibody (N-Term)

Catalog No. ABIN630826

This Rabbit Polyclonal antibody specifically detects Peroxiredoxin 1 in WB. It exhibits reactivity toward Human and Rat.

Quick Overview for Peroxiredoxin 1 antibody (N-Term) (ABIN630826)

Target: Peroxiredoxin 1 (PRDX1)

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Peroxiredoxin 1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Peroxiredoxin 1 Antibody

Binding Specificity: N-Term

Specificity: PRDX1 antibody was raised against the N terminal of PRDX1

Purification: Affinity purified

Immunogen: PRDX1 antibody was raised using the N terminal of PRDX1 corresponding to a region with amino acids SSGNAKIGHPAPNFKATAVMPDGQFKDISLSDYKGKYVVFFFYPLDFTFV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PRDX1 Blocking Peptide, catalog no. 33R-8807, is also available for use as a blocking control in assays to test for specificity of this PRDX1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRDX1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Peroxiredoxin 1

Target: Peroxiredoxin 1 (PRDX1)

Alternative Name: PRDX1

Background: PRDX1 is a member of the peroxiredoxin family of antioxidant enzymes, which reduce hydrogen peroxide and alkyl hydroperoxides. It may play an antioxidant protective role in cells, and may contribute to the antiviral activity of CD8(+) T-cells. This protein may have a proliferative effect and play a role in cancer development or progression.

Molecular Weight: 22 kDa (MW of target protein)

Pathways: p53 Signaling, EGFR Signaling Pathway, CXCR4-mediated Signaling Events