Peroxiredoxin 1 antibody (N-Term)
-
- Target See all Peroxiredoxin 1 (PRDX1) Antibodies
- Peroxiredoxin 1 (PRDX1)
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Peroxiredoxin 1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- PRDX1 antibody was raised against the N terminal of PRDX1
- Purification
- Affinity purified
- Immunogen
- PRDX1 antibody was raised using the N terminal of PRDX1 corresponding to a region with amino acids SSGNAKIGHPAPNFKATAVMPDGQFKDISLSDYKGKYVVFFFYPLDFTFV
- Top Product
- Discover our top product PRDX1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PRDX1 Blocking Peptide, catalog no. 33R-8807, is also available for use as a blocking control in assays to test for specificity of this PRDX1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRDX1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Peroxiredoxin 1 (PRDX1)
- Alternative Name
- PRDX1 (PRDX1 Products)
- Synonyms
- MSP23 antibody, NKEF-A antibody, NKEFA antibody, PAG antibody, PAGA antibody, PAGB antibody, PRX1 antibody, PRXI antibody, TDPX2 antibody, NkefA antibody, OSF-3 antibody, OSF3 antibody, Paga antibody, PrdxI antibody, PrxI antibody, TDX2 antibody, TPxA antibody, Tdpx2 antibody, prx1 antibody, Hbp23 antibody, MGC80194 antibody, MGC84820 antibody, PRDX1 antibody, msp23 antibody, nkefa antibody, pag antibody, paga antibody, pagb antibody, prx-1 antibody, prxi antibody, tdpx2 antibody, hm:zehl0637 antibody, zgc:110343 antibody, TPX-2 antibody, peroxiredoxin 1 antibody, peroxiredoxin 1 S homeolog antibody, peroxiredoxin-1 pseudogene antibody, PRDX1 antibody, Prdx1 antibody, prdx1.S antibody, prdx1 antibody, LOC100350232 antibody
- Background
- PRDX1 is a member of the peroxiredoxin family of antioxidant enzymes, which reduce hydrogen peroxide and alkyl hydroperoxides. It may play an antioxidant protective role in cells, and may contribute to the antiviral activity of CD8(+) T-cells. This protein may have a proliferative effect and play a role in cancer development or progression.
- Molecular Weight
- 22 kDa (MW of target protein)
- Pathways
- p53 Signaling, EGFR Signaling Pathway, CXCR4-mediated Signaling Events
-