ATE1 antibody (N-Term)

Catalog No. ABIN630829

This Rabbit Polyclonal antibody specifically detects ATE1 in WB. It exhibits reactivity toward Human.

Quick Overview for ATE1 antibody (N-Term) (ABIN630829)

Target: ATE1 (Arginyltransferase 1 (ATE1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ATE1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-ATE1 Antibody

Binding Specificity: N-Term

Specificity: ATE1 antibody was raised against the N terminal of ATE1

Purification: Affinity purified

Immunogen: ATE1 antibody was raised using the N terminal of ATE1 corresponding to a region with amino acids CCPQYTIRCRPLQFQPSKSHKKVLKKMLKFLAKGEVPKGSCEDEPMDSTM

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ATE1 Blocking Peptide, (ABIN937040), is also available for use as a blocking control in assays to test for specificity of this ATE1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ATE1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ATE1

Target: ATE1 (Arginyltransferase 1 (ATE1))

Alternative Name: ATE1

Background: ATE1 is an arginyltransferase, an enzyme that is involved in posttranslational conjugation of arginine to N-terminal aspartate or glutamate residues. Conjugation of arginine to the N-terminal aspartate or glutamate targets proteins for ubiquitin-dependent degradation. Alternative splicing results in two transcript variants encoding distinct isoforms.

Molecular Weight: 59 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interactome