SCO1 antibody

Catalog No. ABIN630894

This anti-SCO1 antibody is a Rabbit Polyclonal antibody detecting SCO1 in WB. Suitable for Human, Mouse and Rat.

Quick Overview for SCO1 antibody (ABIN630894)

Target: SCO1 (SCO1 Cytochrome C Oxidase Assembly Protein (SCO1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SCO1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-SCO1 Antibody

Purification: Affinity purified

Immunogen: SCO1 antibody was raised using a synthetic peptide corresponding to a region with amino acids ALLAGMKHVKKEKAEKLEKERQRHIGKPLLGGPFSLTTHTGERKTDKDYL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SCO1 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this SCO1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SCO1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SCO1

Target: SCO1 (SCO1 Cytochrome C Oxidase Assembly Protein (SCO1))

Alternative Name: SCO1

Background: Mammalian cytochrome c oxidase (COX) catalyzes the transfer of reducing equivalents from cytochrome c to molecular oxygen and pumps protons across the inner mitochondrial membrane.

Molecular Weight: 34 kDa (MW of target protein)

Pathways: Sensory Perception of Sound, Transition Metal Ion Homeostasis, Stem Cell Maintenance, Production of Molecular Mediator of Immune Response, Regulation of long-term Neuronal Synaptic Plasticity