PPP2R3A antibody

Catalog No. ABIN630911

The Rabbit Polyclonal anti-PPP2R3A antibody is suitable to detect PPP2R3A in samples from Human. It has been validated for WB.

Quick Overview for PPP2R3A antibody (ABIN630911)

Target: PPP2R3A (Protein Phosphatase 2, Regulatory Subunit B'', alpha (PPP2R3A))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PPP2R3A antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-PPP2R3A Antibody

Purification: Affinity purified

Immunogen: PPP2 R2 antibody was raised using a synthetic peptide corresponding to a region with amino acids SSSVEEKPLSHRNSLDTNLTSMFLQNFSEEDLVTQILEKHKIDNFSSGTD

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PPP2R3A Blocking Peptide, (ABIN5615519), is also available for use as a blocking control in assays to test for specificity of this PPP2R3A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPP0 0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PPP2R3A

Target: PPP2R3A (Protein Phosphatase 2, Regulatory Subunit B'', alpha (PPP2R3A))

Alternative Name: PPP2R3A

Background: Protein phosphatase 2 (formerly named type 2A) is one of the four major Ser/Thr phosphatases and is implicated in the negative control of cell growth and division.

Molecular Weight: 130 kDa (MW of target protein)

Pathways: PI3K-Akt Signaling