PTGDS antibody (N-Term)

Catalog No. ABIN630956

The Rabbit Polyclonal anti-PTGDS antibody has been validated for WB. It is suitable to detect PTGDS in samples from Human, Mouse and Rat.

Quick Overview for PTGDS antibody (N-Term) (ABIN630956)

Target: PTGDS (Prostaglandin D2 Synthase (PTGDS))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PTGDS antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-PTGDS Antibody

Binding Specificity: N-Term

Specificity: PGDS antibody was raised against the N terminal of PGDS

Purification: Affinity purified

Immunogen: PGDS antibody was raised using the N terminal of PGDS corresponding to a region with amino acids EQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEME

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PGDS Blocking Peptide, (ABIN938043), is also available for use as a blocking control in assays to test for specificity of this PGDS antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PGDS antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PTGDS

Target: PTGDS (Prostaglandin D2 Synthase (PTGDS))

Alternative Name: PGDS

Background: PGDS is a sigma class glutathione-S-transferase family member. The enzyme catalyzes the conversion of PGH2 to PGD2 and plays a role in the production of prostanoids in the immune system and mast cells. The presence of this enzyme can be used to identify the differentiation stage of human megakaryocytes. Prostaglandin-D synthase is a sigma class glutathione-S-transferase family member. The enzyme catalyzes the conversion of PGH2 to PGD2 and plays a role in the production of prostanoids in the immune system and mast cells. The presence of this enzyme can be used to identify the differentiation stage of human megakaryocytes.

Molecular Weight: 23 kDa (MW of target protein)