PARD6B antibody

Catalog No. ABIN630967

Product Details anti-PARD6B Antibody

Target: PARD6B (Par-6 Partitioning Defective 6 Homolog beta (PARD6B))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PARD6B antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: PARD6 B antibody was raised using a synthetic peptide corresponding to a region with amino acids MNRSHRHGAGSGCLGTMEVKSKFGAEFRRFSLERSKPGKFEEFYGLLQHV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PARD6B Blocking Peptide, catalog no. 33R-6265, is also available for use as a blocking control in assays to test for specificity of this PARD6B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PARD0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PARD6B

Target: PARD6B (Par-6 Partitioning Defective 6 Homolog beta (PARD6B))

Alternative Name: PARD6B (PARD6B Products)

Synonyms: PARD6B antibody, AV025615 antibody, Par6b antibody, PAR6B antibody, par-6 antibody, par6 antibody, pard6beta antibody, si:dkey-192i18.6 antibody, PAR-6 antibody, PAR-6B antibody, par-6 family cell polarity regulator beta antibody, par-6 family cell polarity regulator beta S homeolog antibody, par-6 partitioning defective 6 homolog beta (C. elegans) antibody, PARD6B antibody, Pard6b antibody, pard6b.S antibody, pard6b antibody

Background: This gene is a member of the PAR6 family and encodes a protein with a PSD95/Discs-large/ZO1 (PDZ) domain, an OPR domain and a semi-Cdc42/Rac interactive binding (CRIB) domain. This cytoplasmic protein is involved in asymmetrical cell division and cell polarization processes as a member of a multi-protein complex.

Molecular Weight: 41 kDa (MW of target protein)

Pathways: Cell-Cell Junction Organization