MRPL39 antibody (N-Term)

Catalog No. ABIN630985

This Rabbit Polyclonal antibody specifically detects MRPL39 in WB. It exhibits reactivity toward Human.

Quick Overview for MRPL39 antibody (N-Term) (ABIN630985)

Target: MRPL39 (Mitochondrial Ribosomal Protein L39 (MRPL39))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MRPL39 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-MRPL39 Antibody

Binding Specificity: N-Term

Specificity: MRPL39 antibody was raised against the N terminal of MRPL39

Purification: Affinity purified

Immunogen: MRPL39 antibody was raised using the N terminal of MRPL39 corresponding to a region with amino acids TELTEMRNDLFNKEKARQLSLTPRTEKIEVKHVGKTDPGTVFVMNKNIST

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MRPL39 Blocking Peptide, (ABIN5614843), is also available for use as a blocking control in assays to test for specificity of this MRPL39 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MRPL39 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MRPL39

Target: MRPL39 (Mitochondrial Ribosomal Protein L39 (MRPL39))

Alternative Name: MRPL39

Background: Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. MRPL39 is a 39S subunit protein. Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion.

Molecular Weight: 39 kDa (MW of target protein)