OXSM antibody (Middle Region)

Catalog No. ABIN630986

The Rabbit Polyclonal anti-OXSM antibody has been validated for WB. It is suitable to detect OXSM in samples from Human, Rat and Mouse.

Quick Overview for OXSM antibody (Middle Region) (ABIN630986)

Target: OXSM (3-Oxoacyl-ACP Synthase, Mitochondrial (OXSM))

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This OXSM antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-OXSM Antibody

Binding Specificity: Middle Region

Specificity: OXSM antibody was raised against the middle region of OXSM

Purification: Affinity purified

Immunogen: OXSM antibody was raised using the middle region of OXSM corresponding to a region with amino acids HAVQRRARIYAEVLGYGLSGDAGHITAPDPEGEGALRCMAAALKDAGVQP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

OXSM Blocking Peptide, (ABIN939082), is also available for use as a blocking control in assays to test for specificity of this OXSM antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OXSM antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for OXSM

Target: OXSM (3-Oxoacyl-ACP Synthase, Mitochondrial (OXSM))

Alternative Name: OXSM

Background: OXSM is a mitochondrial beta-ketoacyl synthase (EC 2.3.1.41) involved in mitochondrial fatty acid synthesis. It is required for catalysis of the chain-elongating condensation reaction.

Molecular Weight: 49 kDa (MW of target protein)