PARP2 antibody
-
- Target See all PARP2 Antibodies
- PARP2 (Poly (ADP-Ribose) Polymerase 2 (PARP2))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PARP2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- PARP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LLDLFEVEKDGEKEAFREDLHNRMLLWHGSRMSNWVGILSHGLRIAHPEA
- Top Product
- Discover our top product PARP2 Primary Antibody
-
-
- Application Notes
-
WB: 1.6 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PARP2 Blocking Peptide, catalog no. 33R-5123, is also available for use as a blocking control in assays to test for specificity of this PARP2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PARP2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PARP2 (Poly (ADP-Ribose) Polymerase 2 (PARP2))
- Alternative Name
- PARP2 (PARP2 Products)
- Background
- PARP2 contains a catalytic domain and is capable of catalyzing a poly(ADP-ribosyl)ation reaction. This protein has a catalytic domain which is homologous to that of poly (ADP-ribosyl) transferase, but lacks an N-terminal DNA binding domain which activates the C-terminal catalytic domain of poly (ADP-ribosyl) transferase. The basic residues within the N-terminal region of this protein may bear potential DNA-binding properties, and may be involved in the nuclear and/or nucleolar targeting of protein.
- Molecular Weight
- 61 kDa (MW of target protein)
- Pathways
- DNA Damage Repair
-