PARP2 antibody

Catalog No. ABIN631010

The Rabbit Polyclonal anti-PARP2 antibody has been validated for WB. It is suitable to detect PARP2 in samples from Human.

Quick Overview for PARP2 antibody (ABIN631010)

Target: PARP2 (Poly (ADP-Ribose) Polymerase 2 (PARP2))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PARP2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-PARP2 Antibody

Purification: Affinity purified

Immunogen: PARP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LLDLFEVEKDGEKEAFREDLHNRMLLWHGSRMSNWVGILSHGLRIAHPEA

Application Details

Application Notes: WB: 1.6 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PARP2 Blocking Peptide, (ABIN940509), is also available for use as a blocking control in assays to test for specificity of this PARP2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PARP2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PARP2

Target: PARP2 (Poly (ADP-Ribose) Polymerase 2 (PARP2))

Alternative Name: PARP2

Background: PARP2 contains a catalytic domain and is capable of catalyzing a poly(ADP-ribosyl)ation reaction. This protein has a catalytic domain which is homologous to that of poly (ADP-ribosyl) transferase, but lacks an N-terminal DNA binding domain which activates the C-terminal catalytic domain of poly (ADP-ribosyl) transferase. The basic residues within the N-terminal region of this protein may bear potential DNA-binding properties, and may be involved in the nuclear and/or nucleolar targeting of protein.

Molecular Weight: 61 kDa (MW of target protein)

Pathways: DNA Damage Repair